PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00008.1.g08520.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 717aa    MW: 76765 Da    PI: 10.7944
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00008.1.g08520.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.75.3e-41116192278
                                   -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                           SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                                   C v+gC+adls+ ++yhrrhkvCe+hsk+p+v+v+g+e rfCqqCsrfh l efDe+krsCr+rL++hn+rrrk+q+
  Zjn_sc00008.1.g08520.1.am.mk 116 CAVDGCKADLSKGRDYHRRHKVCEAHSKTPTVVVAGREMRFCQQCSRFHLLAEFDEAKRSCRKRLDGHNRRRRKPQP 192
                                   **************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.2E-35108177IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.188113190IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.79E-38114195IPR004333Transcription factor, SBP-box
PfamPF031101.9E-31116189IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 717 aa     Download sequence    Send to blast
MPVSWDLADL EHDAVPAISA ATATDPAAAS RIDAAAVAAS AATRGAPNRA ECSVDLKLGG  60
LGDFGAADAM KEPKPPAAKG PAVPASSAAA VVPSASPLKR PRTGPGGANG PQCPSCAVDG  120
CKADLSKGRD YHRRHKVCEA HSKTPTVVVA GREMRFCQQC SRFHLLAEFD EAKRSCRKRL  180
DGHNRRRRKP QPDNMNSGSF MTTQQGARFS SFVAPRPEPS WSGIIKSEDT SYYAHQVLSN  240
RPHFTVTGCT STYSKEGRRF PFLQDGDQVS FGTGGAASLE VATACQPLLQ TVAAAPPPES  300
SSSNKIFSPD GLTPVLDSDC ALSLLSSPAN SSSVDVSRMV QTAEHIPMAQ PLVPSLQQFG  360
SSHRWFSQAA SSGVVVSTAG FACPSMESEQ MNPVLVPSSD GHEMNYHGIF HVGGEGSSDG  420
TSPPLPFSWQ DNRPQTRLWR EAAVPACRYP MALAEGPRLR RVTCYPGDGR ESLELEKWGF  480
ARLPAAVKRT KAPCRAVPET ATRASTAYAR RGSIVAAGGP EPSILDAIKH SCTSSAPRRR  540
HCGLRVARTG DVRVVPARRV RFASSRRYMT PWRLRADRSY EEGVHGALAV ARGSCTVGAL  600
RPLARLDEIH GRKASKGTAR TQRRMLRVTR RPSGPSNPPA GTTYDLPRSG RRRRTDVPIK  660
RARHRRALRS VPAPRSLRRR PSCPGPRVSH GKMSALPASP ALDASPGLLR PIGIVDG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-28104189184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1172189KRSCRKRLDGHNRRRRKP
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0538751e-100BT053875.1 Zea mays full-length cDNA clone ZM_BFb0379K14 mRNA, complete cds.
GenBankFP0949131e-100FP094913.1 Phyllostachys edulis cDNA clone: bphyem212i14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008667767.10.0PREDICTED: uncharacterized protein LOC100279240 isoform X1
SwissprotQ0J0K11e-156SPL18_ORYSJ; Squamosa promoter-binding-like protein 18
TrEMBLA0A096QV130.0A0A096QV13_MAIZE; Uncharacterized protein
STRINGGRMZM2G061734_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP17553795
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.11e-40SBP family protein